PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C000201P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 174aa    MW: 19399 Da    PI: 8.8006
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C000201P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.2e-3850108260
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                     +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvP+G+grr+ k 
  MELO3C000201P1  50 PEKIIPCPRCKSMDTKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPIGAGRRRAKP 108
                     68999**************************************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2849107IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3152107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.23954108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MAEVHSSNAD GIKLFGTMIH LQTRKLKEEP EKGGPVAGGG EGDETEMKRP EKIIPCPRCK  60
SMDTKFCYFN NYNVNQPRHF CKGCQRYWTA GGALRNVPIG AGRRRAKPPP NCRTLSGELS  120
EDYGQYYDAA SGIIHQLELD AVEGWHLTVA EQDFTKVFPF KRRKIIGQHG QTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6843880.0LN684388.1 Cucumis melo genomic scaffold, unassembled_sequence31902.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008467024.11e-130PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotO229671e-49CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A0A0KKD01e-119A0A0A0KKD0_CUCSA; Uncharacterized protein
STRINGVIT_10s0003g01260.t011e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64833251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.13e-49Dof family protein